DPCstruct | MC29626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2794 |
|---|---|
| Mean domain length (aa) | 147 ± 27 aa |
| Standard deviation of domain lengths | 26.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.42 |
| Pfam Score | 96.73 |
| Assigned Pfam label(s) | CL0221- PF19257- CL0062- CL0219- PF12535 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5HY08 | 74-203 | IEEPPFVLPAGKQAAAGAVVVEPDGRLWLVAPSNAFGGYTATFPKGRAMGASLRATAIRETWEESGLSIVLTGWLGDFSRTQTHTRF… |
| A0A1I5DVG0 | 23-179 | SQAHAEGVRHRTAHIWVVRDNGDKTEVLLQKRALNKDSFPGRYDTSSAGHIQAGDEPLESAIRELSEELGIQADADDLNFAGTFPIQ… |
| A0A7S4P767 | 492-658 | None |
| A0A6A0JMY5 | 79-208 | None |
| A0A7Y2ITW8 | 2-146 | None |
| A0A7Y3DJS5 | 92-258 | None |
| A0A1G6QDA0 | 26-154 | None |
| A0A7Y4ZKQ3 | 2-130 | None |
| A0A7K0C2I6 | 2-119 | None |
| A0A7R9KNG4 | 256-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.