DPCstruct | MC29619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YHN7 | 118-224 | EKAFKQRLKEIQMSEYDASTYERFSGAVRRQVQSLRIILDNLQAKGKERQWLRHQAVGELDDAKIIDSLTGEKSIYKRRGELDPQLG… |
| A0A482XJX3 | 1-110 | MAKKAFQERLKEIQMSDFDAKVYDQFYSTVAKQIQSLRVILSSVQAKTKERQWNRHQTSGELDDSKLIEGITGEKNIYRRRAEKDPE… |
| L5KHP6 | 181-283 | None |
| A0A0D8XAL9 | 337-450 | None |
| Q19346 | 1518-1625 | None |
| A0A5N5SPY1 | 609-717 | None |
| M4B1C1 | 265-359 | None |
| A0A3M7S582 | 244-314 | None |
| A0A6A4WT96 | 21-129 | None |
| A0A4P9Y032 | 78-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.