DPCstruct | MC29613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 417 ± 108 aa |
| Standard deviation of domain lengths | 107.62 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 39.56 |
| Assigned Pfam label(s) | CL0525- CL0159- PF21167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819CRV8 | 22-428 | SLIAELQSTPMDTVLFWNMVTLQACANDYDRSIAPVPDQIGPTATSRALAIIHGAMYESLTAFNRAFKPMWKSKNFPVLGDVSRESI… |
| K9TLY9 | 139-552 | IVSLWSEAAQQAVRNTGPGPTIASRAYAIVMTAMFDTWAAYDETAIATQLGDTLQRPSAENTVSNKSEAMSYAAYRTLNDIFPTQGE… |
| A0A534ZA51 | 274-854 | None |
| A4YMN4 | 104-648 | None |
| A0A6B2M325 | 457-1039 | None |
| A0A5B9MPZ4 | 328-816 | None |
| A0A193C020 | 13-431 | None |
| A0A2V7IQ16 | 13-315 | None |
| C1N4N7 | 6-433 | None |
| A0A7X5VP49 | 25-617 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.