DPCstruct | MC29610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7VJP5 | 30-163 | VQWVSYICSLIGIPKEGVELCAQILSLKPPTRLVWLHLAECTGCSSSFLRLDKPDIESVLLEYITLEYHETIMGAVGFSAKKSLHNT… |
| A0A0R3JRQ4 | 7-137 | CYNEVLSNKNNMAHYIAMEAVNAIKTGRRKKINVIWIEATGCFGNTISLMNGKNPDLGYLLSEMINLEYSNSIMTCEGEGAFELFLK… |
| A0A7V4JRC2 | 36-196 | None |
| A0A101G1K4 | 1-155 | None |
| A0A376UIG1 | 2-147 | None |
| A0A011PYR3 | 323-429 | None |
| A0A4R6A2D8 | 7-145 | None |
| A0A011Q7N2 | 15-164 | None |
| A2BMI5 | 6-156 | None |
| G1UYL0 | 41-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.