DPCstruct | MC2961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 16 aa |
| Standard deviation of domain lengths | 16.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3U4YER9 | 1-115 | MYSTSAVLEITKDFQIILNRPSPENSNYHAYVVDYLKQQHLPDDFFKRLILKQEYFKEGVEFIINCIIIDWVLKDDDGYAIPFNLTD… |
| A0A4R3W2A3 | 3-137 | LQLTKKDQAPAGARWVEFDKDTKVLLAGIDNAEYQVGLERMRRRIARNDARFEEGQVGVVAGELTEHQNHAMLLAHFIVKDWSGVLD… |
| A0A5P9HE64 | 1-175 | None |
| A0A1V2H253 | 12-151 | None |
| A0A081BFR4 | 2-133 | None |
| A0A497PMT0 | 4-115 | None |
| H6SL09 | 63-192 | None |
| A0A7W6RG75 | 13-127 | None |
| A0A5R9HIS0 | 2-113 | None |
| A0A4Z0F7S1 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.