DPCstruct | MC29606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 79 ± 2 aa |
| Standard deviation of domain lengths | 2.38 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 95.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 50.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835VI98 | 95-172 | DKHFYSASFEENLPVLLGLLSVWNVSFLGFPARAILPYSQALEKLAPHIQQVSMESNGKGVSIDGVPLPFETGEIDFG |
| A0A6M1CIV8 | 142-217 | DKHFTETEFSQNIPVLLALIGLWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKYVDRNGKVVSHQTGPVI |
| A0A7S4A179 | 315-392 | None |
| A0A849G8I5 | 217-298 | None |
| A0A376FFA7 | 1-76 | None |
| A0A6F8T2Q5 | 113-194 | None |
| A0A7V8GWW3 | 2-77 | None |
| A0A855HNP8 | 24-99 | None |
| A0A379GCK0 | 1-76 | None |
| S4MSR7 | 316-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.