DPCstruct | MC29603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 64.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8REM2 | 75-135 | MSRLLNTPDGSPYTWWVGRANEKHYYWGGSGPGIQKCACGIERNCTDPKYYCNCDADYKQW |
| S7MN52 | 7-69 | YLNVPLHFLADGSPYTWWVGKANEKHYYWGGSGPGIQKCACGIERNCTDPKYYCNCDADYKQW |
| A0A834FFA1 | 5-60 | None |
| S9WFN7 | 36-93 | None |
| A0A6I9PJE6 | 108-160 | None |
| G1QBQ5 | 1-51 | None |
| A0A401S7G4 | 99-144 | None |
| A0A401RWN2 | 9-70 | None |
| A0A4W3H0T9 | 12-66 | None |
| A0A553R3D4 | 44-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.