DPCstruct | MC29602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 156 ± 29 aa |
| Standard deviation of domain lengths | 29.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 53.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7WHU8 | 1-134 | MQIRKDRFSIEWIKRDHRTDSPTRLRGERVLLVFEDRQPYDWLTYRRVYLPSSHLEDLIRPGLFQCRYDHLGLMIAMLSFHGKYAMV… |
| A0A091DN00 | 717-885 | MRFKPLFRIHLMERKSATVECMYGHKGPHNGHIQIVKQDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILM… |
| A0A3B1JJK3 | 58-257 | None |
| S4R9Q3 | 70-265 | None |
| L5M587 | 9-121 | None |
| L5LCZ4 | 1-131 | None |
| S7MF64 | 174-315 | None |
| A0A7J8AJY8 | 120-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.