DPCstruct | MC29601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 74 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 55.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7MM05 | 1-78 | MSEFWHKLGCCVVEKPQPKKKRRIDRTMIGEPVNFVHLTHIGSGEMGAGDGLAMTSAVQEQMRSKGNRDRPWSNSRGL |
| A0A7F5RKV2 | 9-82 | VGEIWISWFSCCVAQPQKRHRHRIDRSMIGNPMNFQHTAHIGSRDMEMPNDQLNALQLQMRSKGGYEAAYKETD |
| A0A553PZX7 | 3-74 | None |
| A0A6B0S3I8 | 87-142 | None |
| A0A6L2PUX1 | 2-82 | None |
| A0A663DPH7 | 88-159 | None |
| A0A336MQ72 | 34-127 | None |
| A0A670KBI9 | 1-71 | None |
| B7PV65 | 18-102 | None |
| A0A803Y825 | 129-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.