DPCstruct | MC296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 1 aa |
| Standard deviation of domain lengths | 1.40 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 92.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 59.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2JG39 | 20-85 | IDYLQPENLARLKQRNVSRKQRHALMEFALGIEGVKRFVDKEPISRVHECVLATLALEAEPVDPRL |
| A0A6N9XUB2 | 1-62 | EPENLDRLRRRSLGRKRSLAMREHALGAEALARLAGGEPLWRVHQAVFAVLALESEPVDPRL |
| A0A516PWY4 | 136-200 | None |
| A0A2G7LZ82 | 123-188 | None |
| W7YXD7 | 80-145 | None |
| A0A7C3J7Q2 | 57-122 | None |
| A0A1G8CZU5 | 159-223 | None |
| A0A7X7JUA6 | 210-272 | None |
| A0A7T9DZR6 | 93-155 | None |
| W7ZVV9 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.