DPCstruct | MC29599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 116 ± 7 aa |
| Standard deviation of domain lengths | 6.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4XKK5 | 107-225 | IGMPSISILLHEVTKLLEYAGAHGATYIRMGTSGGIGVDPGTVVITSEGVNNKMESVDEVAVLGSTVLRPSICSPEVREEIITAANE… |
| A0A1U8CXV7 | 1-120 | MGIPSISIMLHELIKLLHHAKCQGVTIIRIGTSGGLGIEPGSVVITDTALDSFFKPQFEQVILDNVVVRSTELDKDLAEELLNCSKE… |
| A0A7J6PM95 | 374-483 | None |
| T1KTE8 | 167-287 | None |
| A0A662WPF0 | 476-594 | None |
| A0A0V0YEX5 | 79-185 | None |
| A0A672HUA2 | 109-219 | None |
| A0A5K3FSN8 | 52-160 | None |
| A0A8B6CNB7 | 44-153 | None |
| A9V919 | 106-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.