DPCstruct | MC29597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 89 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 51.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7MEZ6 | 58-139 | MEQSDLASNDAAVDTLFGDMKEKEVRLHEGASSDRYLVHIFRHMAKELFNEDVGVLTYRTLRNKDFQEVTLERDKEVLLRFE |
| A0A3P4KFS3 | 56-156 | TGEVFKLLEEEGVSLSELEPAPLDSLCSGASAQEPTSHRGGGSGGYLEHVFRHAARELFGIHVDEVTYRPLRNKDFQEVTLEKEGRV… |
| A0A7J7VYQ6 | 11-92 | None |
| A0A7R9B8Q0 | 17-95 | None |
| U5DFB8 | 139-240 | None |
| G1Q0V6 | 198-283 | None |
| A0A7J7Z6Q8 | 62-143 | None |
| A0A7J7YWS4 | 20-120 | None |
| A0A6B0R8H3 | 45-126 | None |
| A0A2H0UTS2 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.