DPCstruct | MC29593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 17.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12599 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9I5R2 | 6-99 | IAQKNDLLRKTLSGCRVMLTAGVADSEDQAQVLAAVKSFHQFTEDNDPYGEHDFAFFEVNGERFFFKFDYYDNDYEFYQEDGNRVLT… |
| A0A218QTX8 | 62-176 | KPKLKMSIAELNDRFRQGDTSLGITCMTRNVQALPVNKLAQLIKLVRSFDKFTSNNDPYNEHDLAVVELDGIRYFYKIDYYDREAFR… |
| A0A1I2ERK6 | 36-148 | None |
| A0A2D9TZM5 | 19-142 | None |
| A0A2A2K4T6 | 5-112 | None |
| A0A525IFG3 | 10-105 | None |
| A0A1V0GY99 | 170-280 | None |
| A0A0Q5FB72 | 8-84 | None |
| A0A4Q0Q5W0 | 3-93 | None |
| A0A514XFT5 | 4-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.