DPCstruct | MC2959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 165 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1YVT1 | 2-134 | IGNGLRELDRFLNILLDETMTSHGLKARPDQRNTANKWSHFNNWRGAPPSHERRLRALGRSRNCLFYCAGRINRGDSCMTPIFTAGW… |
| A0A511Q576 | 20-188 | PETSVALAHATLQQGARHIAGLAPWADPMVEGPQAVVRARYVGNCLRELDRFLGVLLDVSCLAPRPRLLTLKPDTATRIAVYEADGW… |
| A0A0Q5Q1A9 | 13-190 | None |
| A0A7X5V3L0 | 4-188 | None |
| A0A1I6KXV2 | 6-188 | None |
| A0A838L079 | 2-127 | None |
| A0A1H7KP21 | 24-200 | None |
| A0A7W9F3R4 | 44-224 | None |
| A0A239I0N2 | 8-151 | None |
| A0A431JKE5 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.