DPCstruct | MC29589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF07485- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M2SUJ0 | 9-104 | VVMRIRNIKATILGRRTRSPLALPFGLSFEEDLNLGESVVLQKEINPLMTALRKRGIIVTAVHNHWLFEEPRLMYMHWEDTGDAFDF… |
| A0A168AVW1 | 29-151 | CKVLKTLFNGASIKQENRICKLEIPRTNLHVTNMGVKLSPEAIGLSFGVNFEQVGDTTAVVGEFALLGEEVNPVIDALRKGNIQVTA… |
| A0A1I6U217 | 43-142 | None |
| A0A1H1W534 | 101-253 | None |
| A0A1Q7JLR2 | 33-147 | None |
| A0A519TLR7 | 111-205 | None |
| A0A6V8SGN6 | 2-80 | None |
| A0A7I7P5T8 | 11-134 | None |
| A0A2V7KKZ5 | 80-201 | None |
| A0A7X0G0Y1 | 16-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.