DPCstruct | MC29584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 244 ± 41 aa |
| Standard deviation of domain lengths | 41.17 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06626 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662I8B3 | 2-246 | LLVGGLGGGGDSAGALALALKFRRIGCDVSILGMVPCSVDSLIGAERLAGSLVKISPDTWAAGRFFEPHIARLGWTVYVLCLNESLS… |
| C8X723 | 2-251 | ERPLYVAAGGGGDALAATLLHRAYGPPGPATIATFSWDRLIVDPLPGPRSFSNFKGLETVGRLEHVVTPRTRPIPPAGSTLPPLARD… |
| A0A516PV17 | 8-254 | None |
| A0A815M767 | 7-274 | None |
| A0A4R2R3T8 | 6-184 | None |
| A0A662V5V7 | 5-244 | None |
| A0A2M6X1E1 | 493-764 | None |
| A0A419HF92 | 3-207 | None |
| A0A7C4QRS3 | 9-194 | None |
| A0A534RZV1 | 12-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.