DPCstruct | MC29583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316TFQ6 | 11-140 | ATYALREEGYDVTRPLPAALHVTGRFLNPERIALRAAGEAGDGPIGVWAVSRENDWTLVAWSRPDLVTITQRGAAPARWRHRRIPPA… |
| C8X710 | 45-190 | VPDPVRDAILMLERTFPDIDVLNAGPTRFDLSGRFSNPSRAAADALVRLEAFPSICVVARGRENRVAALARHQNVLLWIELRPNHNV… |
| A0A1G7SGV5 | 179-311 | None |
| A0A2T0TFA0 | 766-894 | None |
| A0A7X0FXM8 | 14-141 | None |
| A0A1Q9LM18 | 239-370 | None |
| A0A1Q4ZJ14 | 327-461 | None |
| A0A7Y6CMC6 | 53-190 | None |
| A0A1X0BLX6 | 101-224 | None |
| A0A7J5DQY7 | 6-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.