DPCstruct | MC2958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S2TF09 | 80-180 | QMPFTDAWYLENDLRMLHATLVWQLHNRIARKNRSEARIVLDVYAVYQCIVDKPQLDLTRAVFVLSLMAMDLWQQRHCQYCGNAFLA… |
| A0A158AVE2 | 1-116 | MLPFSEDWYLTWAPNIHTSMFANVYAFLETYSDGLDRVDLLTRAYGLYAEHFQMQGELLQMDLTRAWTFIRFRDAGILRLAGCTRCR… |
| A0A841HRT2 | 8-138 | None |
| A0A0L0MG91 | 1-126 | None |
| A1VVC9 | 22-122 | None |
| A0A231HLG2 | 56-184 | None |
| A0A1A9X6T3 | 50-145 | None |
| A0A1B0C1Q4 | 50-153 | None |
| A0A1I3HMF2 | 1-119 | None |
| A0A522Q7J2 | 69-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.