DPCstruct | MC29574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 104 ± 21 aa |
| Standard deviation of domain lengths | 21.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.38 |
| Pfam Score | 93.41 |
| Assigned Pfam label(s) | CL0063- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1H7E8 | 15-94 | AYGRIVCQCNEVSETEVIQAIRDGARTIDGVKFRTRAGFGRCQGGFCSWNIAKIIARELNKDLRDVRQNSEGSWVVDRKV |
| A0A2M8J2K0 | 23-123 | AALARIYPPPQTLPVAPPDDTLICRCEDVRAGDIRAAIAEGAHENFAVKTWTRAGMGPCQGRICGAGIAAALAEAGVPADRASYNRA… |
| A0A847E7H8 | 233-390 | None |
| A0A7S1GEZ1 | 207-332 | None |
| A0A7V3GU20 | 112-256 | None |
| A0A5A7RZP0 | 1-96 | None |
| A0A7X0U4D0 | 405-480 | None |
| A0A7S4URR5 | 149-270 | None |
| A0A0X3QCA1 | 471-558 | None |
| A0A517U4Q9 | 387-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.