DPCstruct | MC29571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6K852 | 1-93 | MKTKAPFELTNKQRKYLGLSPVGDTWELIYFANQYLYYDGDIIRKKITIDDDGTYYEAELCEYTEQNRTILLPKTKRGKPKKMNYTA… |
| A0A496LY58 | 1-109 | MFELSNEQRAYFGLDAVQQSWERVEFAGDKFRPASVLYFEGDVIKKHVVSTDELYAEYGYDEATKGREILLPKTAKGKEAKLTPANF… |
| A0A4Q7N4Y9 | 19-107 | None |
| R9RB71 | 1-84 | None |
| A0A0D3LB73 | 3-101 | None |
| A0A6N7WJA1 | 1-102 | None |
| A0A2M8APA8 | 3-99 | None |
| A0A4R2VVU1 | 14-111 | None |
| A0A2U0ZF30 | 9-110 | None |
| A0A0B7H6V3 | 23-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.