DPCstruct | MC2957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 141 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158ARS4 | 21-164 | ATFRAIAKKYPDRAPQSILADLIESEPGSLGKWFAAAKDAGLLDIALSLAKNHPTDPKTLTRAAREFAVKQPSFAMACGLCALRWMD… |
| A0A2V9X007 | 42-185 | TYLLIAKKYPARDPKQILLDLAESGGDSGHWFAAAKDGGFLDLALEFAQTGRTDPRTLSRASRDLLEKDAKFCLQVARIAIQRMLEG… |
| A0A1Y2KA00 | 262-390 | None |
| A0A7R7GLM6 | 69-218 | None |
| A0A1H9PCR2 | 9-140 | None |
| A0A350SSD1 | 168-312 | None |
| A0A290WTM4 | 2-148 | None |
| A0A2D9J1H6 | 1-122 | None |
| A0A1H8KZ25 | 13-149 | None |
| A0A3D9LK09 | 78-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.