DPCstruct | MC29566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 7.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B1JDL7 | 119-220 | WTASCLEDVCEGTTSPDTSFVIGWPTYNCVATFRTAYQKERWLSLLQSHIREEKELDDPKVIPLKIYAKDTGHCAHAKALSVRNTDC… |
| A0A4W5RS19 | 12-113 | EGSTNPERSFVMGWPTCNCVVTFSSEVQKERWLSLLKSGIKEEKEKDDPKTIPLKVFGKGIGSCAQAVSKTLGVSNSDSTNEVVRLA… |
| A0A6J0VJG0 | 1-103 | None |
| A0A3L7IDN7 | 65-182 | None |
| A0A3Q7V1C8 | 1-104 | None |
| R7TEW5 | 250-367 | None |
| A0A3Q2UFL6 | 1-107 | None |
| A0A0G2K665 | 65-165 | None |
| G3UBN5 | 62-162 | None |
| A0A1U8D362 | 56-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.