DPCstruct | MC29565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5XEF7 | 531-627 | TMKAKQIISFPVHSMGWMDVEEDLMGAQIIGETVNNCITTLANLRHDLHKTEETWANGEDLKLILEGETLKLVHPETKHVYHKQPIA… |
| A0A4W5RMF9 | 1-81 | MAERDLAEGRSSVAVHHCIRQLSYCRRDIRDSAGVWGEGKGMLLVLQDRDLTLVHPDDHSMLHSQPISSIRVWGVGRDHDR |
| A0A4Z2B297 | 573-653 | None |
| A0A484CNJ0 | 24-105 | None |
| A0A670IMR0 | 109-189 | None |
| A0A1A6GLB4 | 162-242 | None |
| A0A667YEJ0 | 80-161 | None |
| A0A3B4EW95 | 136-216 | None |
| A0A1S3FH59 | 129-209 | None |
| A0A096MHF1 | 135-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.