DPCstruct | MC2956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 180 ± 38 aa |
| Standard deviation of domain lengths | 38.11 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0193- PF13954 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9VHC0 | 10-209 | IGNEKIQFKAQPGNNLQTLSCYPGSFFSLLNLSAEKLLAQIPAVQLAPLVQEGYCGSLSELLPGATVSFDVGEQKLTLTIPQLLLNR… |
| A0A157ZWA6 | 6-174 | IRFVASNGGANATPCLTRKMLEGFGVDFEKIAAEHSQDAALQNADACIDPRAQIPGASVDFDFAEQKLSISIPQKYTRNIARGYVSP… |
| A0A2X2TCW3 | 25-266 | None |
| A0A378AXE6 | 55-274 | None |
| A0A484X7X6 | 2-155 | None |
| A0A381GN70 | 95-295 | None |
| A0A2T4I766 | 1-160 | None |
| A0A2X1QG52 | 2-111 | None |
| A0A4U9TSW1 | 5-166 | None |
| A0A6N6X7X6 | 6-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.