DPCstruct | MC29559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 66.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4DQ62 | 7-67 | PFDGGEHPEWRLHAHFYPPLLRSATVRKFMVGYEMLAEAQRDLTSEQAAERLAALSDVHYK |
| A9EK92 | 6-57 | HWQLHGVFYPPLLRSATVKKFMVGYEMLAEAQRDLTPEQAARRLRDATDIHY |
| A0A814DZF7 | 313-375 | None |
| A0A822FNK8 | 52-121 | None |
| A0A3P7LR69 | 69-137 | None |
| A0A498N837 | 3-55 | None |
| A0A7R9KQC7 | 30-86 | None |
| A0A139WKF4 | 119-187 | None |
| A0A0B1SI05 | 36-104 | None |
| A0A4S4MKW0 | 25-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.