DPCstruct | MC29556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 136 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8FL93 | 1-124 | MRRDVLLSYAASTGIIDMDAIELAVEEMKNNEIVEKYHSYAIWKNEKGLWCTHIRDEEGNVKIRRRKTQRELISYLAKHYKHVVNIV… |
| A0A6S6R3B4 | 3-133 | NNDKTLKEAINNGILTVSEVDDMLKMTRKKLVEQKHPYAINSRTNGRVITTVREDGKLKQISAVSMDDMIDKLYLFYFENKKNLTLN… |
| A0A829W127 | 42-182 | None |
| A0A3D1FQ48 | 2-142 | None |
| A0A828SUU8 | 3-135 | None |
| A0A3A6I235 | 15-154 | None |
| R9NBZ1 | 85-210 | None |
| A0A848CN58 | 2-122 | None |
| A0A0E2H6K7 | 38-186 | None |
| A0A415H126 | 12-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.