DPCstruct | MC29552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 130 ± 39 aa |
| Standard deviation of domain lengths | 39.20 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4RHN7 | 9-90 | KWALGILENARLLTTEEFMNLCSAVRLGRSMELIPYPDFKTLNQLIVMVQPSHLQKLAGRYLESSERDIFRANIVRERLQGA |
| A0A5C8X3I8 | 23-184 | LHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQ… |
| A0A3D1TCJ4 | 2-79 | None |
| A0A3D1U9Y6 | 138-299 | None |
| A0A521KCB1 | 597-744 | None |
| A0A7C1HSA9 | 9-144 | None |
| A0A7W1HGS5 | 2-98 | None |
| A0A356KYK0 | 1-63 | None |
| A0A7X6ZRS3 | 65-236 | None |
| A0A2V5QKS5 | 177-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.