DPCstruct | MC2955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 312 ± 19 aa |
| Standard deviation of domain lengths | 19.48 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0713- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KR85 | 3-274 | IPLWTREKVAARILAGENLFILRDQVIRIPQSWLEAHPGGALAILHFVGRDATDEVSAFHSDDTQRRMKGYAVGAVEVGEYGWEPLL… |
| A0A094EG29 | 1-318 | MSRSRVLSRRQIEGLIANNQSIVIFDNKVLRLDKWLERHPGGKLPIQHMVGRDATDEIKIYHSAETLPRMDSFRIGYIDGPWVNFEP… |
| A0A6V8QRC0 | 19-326 | None |
| A0A177TKD4 | 49-355 | None |
| J5JC86 | 3-358 | None |
| A0A420RYN9 | 1-310 | None |
| A0A401KEH5 | 12-308 | None |
| A0A2P7ZE04 | 1-304 | None |
| A0A364N7D8 | 1-319 | None |
| A0A507AZE0 | 454-772 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.