DPCstruct | MC29545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D7A859 | 10-89 | LLLFVPLCVAASNRTIDDTEGDSVTGAVPSYSPSGSWDNADCVGCYIVPSKSEAFDGTWTAATYSPSLTDMSIKFSFTGT |
| A0A0D0CSY7 | 1-102 | MPLRSVFLLLLRGELVCLMLLLDTVLVLCQAVNRSIDDTLGDSVTGQRPLFLPSTLGVWEDNTCKECALQPPTSNAFKGTYTAATYN… |
| A0A5C3LNA2 | 6-98 | None |
| A0A2A9NAG7 | 1-87 | None |
| A0A5C3KTK1 | 1-85 | None |
| B0CX59 | 10-91 | None |
| A0A409Y0N7 | 562-661 | None |
| A0A0C2WHZ0 | 26-102 | None |
| A0A0D0C0Z6 | 8-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.