DPCstruct | MC29543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2C392 | 21-83 | LIDFDINADLTSVFNWNVKELFVYLVYEFQTPKQEFNQVVVWDDIILNKQDAHIKGKNVEAEY |
| A0A0D0CI35 | 4-77 | LNFNLTADLTPLFTWNTKQLFLSLEAEYENIHGVHNTIVLWDRIVRRPEDARVKVVGAKNKYAYKEIGGKGFGK |
| A0A820SRH5 | 1-66 | None |
| A0A6T7PA67 | 2-68 | None |
| A0A3S3SIU9 | 535-603 | None |
| A0A445F9F6 | 1-73 | None |
| A0A059B6B8 | 64-126 | None |
| A0A150GNM5 | 208-270 | None |
| A0A5N6MB42 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.