DPCstruct | MC2954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 202 ± 22 aa |
| Standard deviation of domain lengths | 22.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7XJL4 | 1-206 | MVNFRHVVIASLVGGTVADSFNKSSCPETEWLVFNNTNVADLAPCSVFNYHCPVNGTNELMEYNSTTGPAPADCVNYGYNLAISTNS… |
| A0A094E8V2 | 1-206 | MPPVVQLARVMSLWRTREGFKSQKHAYGVGPTLENISKTTDAEFYFDVTEDVALFVRCAETTYECDATLHGVRWFMIDGTNEPVPAD… |
| A0A094G0A0 | 1-163 | None |
| A0A094EUS9 | 603-825 | None |
| A0A194X1P3 | 1-241 | None |
| A0A1B8GEJ9 | 195-374 | None |
| A0A094B359 | 1-190 | None |
| A0A094ENI9 | 1-218 | None |
| A0A094AF18 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.