DPCstruct | MC29539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6SGP6 | 109-244 | FTQIKQQKSFPTKDQVILESLSKSSNSDENKKNSEKKSSRCMWNENSVRLLLSFLIEHKKKVAKIAKTRQHGGNKIKTKLWNDAVAM… |
| A0A2H5UA20 | 166-316 | YSPRQCSVKWNNIKAKFKDDMVKSCNNPIQVRYKTEIEEILGRSHYYSGINKYRRWDDGAIKLLFLFLIDRKDAVRLLSTNRGDIKL… |
| A0A2Z6RQ90 | 210-348 | None |
| A0A2I1EM44 | 272-393 | None |
| A0A397T4Y1 | 90-254 | None |
| U9UP64 | 1-124 | None |
| A0A2Z6S6W4 | 106-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.