DPCstruct | MC29535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 217 ± 36 aa |
| Standard deviation of domain lengths | 35.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0P145 | 41-305 | TTDSLTATITQQPNNITTLVSAFMQMITAVSSSNNLAAFTTPSVNPSNNQIINQDTTIITKPSSQVNDNLLVNLFIDECKILFIRIQ… |
| A0A397W5J3 | 3-173 | QCKLLFLHTRNPTRKICEKLIKKIVPSMDPLSKEFKMLYRKTREYFDNFRCTFNKDMVALAKDLLVKNCDPTDKNIEQFVAGRVWRQ… |
| A0A397VC83 | 242-465 | None |
| A0A2H5R7R2 | 20-223 | None |
| A0A2H5RXG3 | 182-428 | None |
| A0A397UIH0 | 2-167 | None |
| A0A372Q356 | 18-230 | None |
| A0A372QS59 | 144-348 | None |
| A0A2I1GFB2 | 243-426 | None |
| A0A015LFX0 | 7-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.