DPCstruct | MC2953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 185 ± 29 aa |
| Standard deviation of domain lengths | 29.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 94.88 |
| Assigned Pfam label(s) | CL0137- CL0014- CL0329- CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7X2I7 | 2-193 | RKAEVNRSTGETQVQLYLDLDGSGWSEIDTGIGFMDHMLVLLAKHAGFDLKVKCQGDVYVDDHHSVEDIGISLGLAFAKALGDKQGI… |
| A0A6H5L408 | 272-460 | SEEKRDATGVRRAEISRKTNETAITVDISLDGTGKAEVDTGLGFLDHMLHAMAKHGHLDLKLTCKGDLHIDDHHTAEDCAIALGEAF… |
| A0A5N6PZH9 | 65-197 | None |
| R1C3L4 | 147-413 | None |
| A0A446MPZ1 | 19-179 | None |
| A0A1E7FWI6 | 14-228 | None |
| A0A7C7DPR3 | 510-715 | None |
| A0A812ISN5 | 1-122 | None |
| A0A7X7XEC6 | 4-187 | None |
| A0A645C0K0 | 96-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.