DPCstruct | MC29524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 314 |
|---|---|
| Mean domain length (aa) | 187 ± 36 aa |
| Standard deviation of domain lengths | 35.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | CL0192- PF08883- PF11807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5ACM6 | 23-217 | TDWYSPVHNEARIDFIDVKVNGTLLDLDHSLFRAPPSPQVDAAWERISSLAPHVIRTDHVLRLGKDPAVTARWSADWGFGPDAHVAE… |
| A0A6A6I4G9 | 33-207 | LLYLSILITLALGASVFVGFLIGKSSAAGASLIPVPLTTRQFVYDRSFSYPPNNITNGAWGTLFPRQGGFFSHEPTIPDRSTLSVFH… |
| A0A094JPQ8 | 679-901 | None |
| A0A4U0XQG4 | 23-242 | None |
| W9WIZ1 | 33-224 | None |
| A0A317VNE2 | 5-137 | None |
| E5R1A5 | 92-316 | None |
| A0A1V8SGZ3 | 52-265 | None |
| A0A1B7YC23 | 57-298 | None |
| A0A0H2S4K0 | 14-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.