DPCstruct | MC29523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 441 ± 117 aa |
| Standard deviation of domain lengths | 117.22 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365MTK4 | 45-338 | MPDLPSPAKVRRQAREYSTKIYANHHLLKQILERHESKIQKRWTKKTRQQRLQILLKAWPAMPATHRPDFEAFRKESKQLRERGSKY… |
| A0A6A6I2J0 | 1-477 | MKSLHSENARAPYPETDVEQLAQEVTPKVIAHWTRLHAIVERHELLIHHLWRKKTKMKRRELLLSAWPNMPEVHRPASFTKRGSFRD… |
| A0A4Z1HRH9 | 12-570 | None |
| A0A1V8SG82 | 1-587 | None |
| A0A229Y081 | 2-402 | None |
| A0A4Z1HTK0 | 38-405 | None |
| A0A1V6T2K0 | 135-770 | None |
| A0A4Y7Q790 | 14-407 | None |
| A0A3L6N0U8 | 88-384 | None |
| A0A420SKD8 | 5-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.