DPCstruct | MC29520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7WJB1 | 19-108 | MAQGNITYIDQVPGYASLPTCAESQLSIIVRDMSSGCGASSSYGCFCSTRYATMNTIIATAVYSDCHDGADANSAVAVFADYCSSTP… |
| A0A6A6HT75 | 3-107 | PSLVQPLLLLIFTAFTIAIGPTSIFINQVPEYSLLSQCAETEVSTIVRDMAYGCGDDSRTTSFACFCYDSSAKFSGMIGRHVQTACT… |
| A0A6A6B4P3 | 10-118 | None |
| A0A423XDJ1 | 598-698 | None |
| A0A7J6JET7 | 23-117 | None |
| A0A4T0VYQ6 | 1-104 | None |
| A0A6A6SFV8 | 12-130 | None |
| R1GQU2 | 8-154 | None |
| A0A2T2PBE3 | 5-122 | None |
| A0A6A6TDP4 | 16-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.