DPCstruct | MC29517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 171 ± 26 aa |
| Standard deviation of domain lengths | 25.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 81.72 |
| Assigned Pfam label(s) | PF18256- PF07743- CL0063- CL0521- PF01521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A424NHV2 | 7-167 | NFFELFQLEVGFEVDLERLRGQFQILQREVHPDRYADQDPRSQRLATQWSMRVNEAFAVLSKPLSRAIYLLGLANVELEQNPSLEPE… |
| A0A1W1C547 | 3-163 | NYFSIFDLKTDFEIDKIKLEQQYKEQIAQFHPDKFANSTADEKSQALQNTSLINTAYNTLKSDLNRAIYLLELNNIYPFDEKDTQMD… |
| A0A6A5DM43 | 287-477 | None |
| A0A2B4SHC8 | 52-239 | None |
| A0A2G2QP79 | 17-180 | None |
| A0A4Y7L096 | 578-763 | None |
| W6TF23 | 8-140 | None |
| A0A2G5UC51 | 43-163 | None |
| A0A800LRM9 | 3-103 | None |
| A0A1W0E7J3 | 11-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.