DPCstruct | MC29516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 251 ± 39 aa |
| Standard deviation of domain lengths | 39.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0WW10 | 2-251 | TIYYYSVDVDGLVFNKKYNAGPQSPTKHSSELVITANQGYYDSIRAEAESMGATKRVLMIGTNRQDQQHDAENALMRDGCSSAFPAL… |
| A0A0W0XWB6 | 1-242 | MALIRAISLDFDGAIFNGDFHRHKDVIRANKALLDLIANNAEGYESTTLYAGTNRQSISDDAANAHRNDTGSAFPHLMQLTAYLNKF… |
| A0A0W0TDT1 | 1-304 | None |
| A0A1F8VCJ6 | 2-213 | None |
| A0A1G0YDS0 | 1-245 | None |
| K1XT72 | 6-355 | None |
| A0A3A5L3X1 | 7-254 | None |
| A0A1G0H8C6 | 2-206 | None |
| A0A378I8D1 | 1-290 | None |
| A0A0W0YGL5 | 379-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.