DPCstruct | MC2951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 411 ± 72 aa |
| Standard deviation of domain lengths | 72.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0101- CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5L234 | 4-455 | PQALCVLCGYFCDKASSDGDGHAAKLAETISGWFWPVHGRTALPPVRQHMEVFAVRMCRAYPDLFLTAVVKELKDFRLPGQVLCSLL… |
| Q6YQX1 | 616-1050 | NLDKISILFFTKTIIAFMLAVAVILFNFLRRPCYYPLSPLKLQFVMDYWSIGIPSLFLSFEKNNEIISKNFLLNNLKKAFPYASLAF… |
| A0A195B872 | 3-320 | None |
| A0A044TWG8 | 157-572 | None |
| A0A6L5CVZ0 | 743-1188 | None |
| A0A287Q454 | 1-318 | None |
| A0A1S8VIH4 | 206-685 | None |
| A0A6P4IDG0 | 643-1093 | None |
| Q54XF8 | 1148-1675 | None |
| A0A7J6Q8L4 | 158-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.