DPCstruct | MC29502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 59.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1S9W2 | 2-46 | DSDCWDVQLKFFDPENSRRARKIFRFTIDVSDLIPVTLGEVRSWS |
| A0A8B6KQ27 | 26-78 | SPVSRPDSGCWDVVLEFFNPKERLTTARKLYRDTIDVSDIMPVTIGTLRSWYV |
| B0JFK5 | 426-481 | None |
| A0A6L3ETP4 | 396-450 | None |
| A0A0D4DH05 | 253-311 | None |
| A0A846DKN1 | 1094-1149 | None |
| K9RL50 | 1070-1125 | None |
| A0A846BTK8 | 2-58 | None |
| A0A0S6UZH7 | 947-1002 | None |
| B4W186 | 176-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.