DPCstruct | MC29500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 6.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2R8C4 | 2-103 | DLPDLVIHSKLEAVVQGDFVRHSFPRRGRLGREWKVVVTETWKRKARLGSGGFGTVWLEECQEPASGSSPRCRAVKEIMVGSKSNLD… |
| A0A5M8PUT4 | 2-104 | ASAASDLLAHFKLEAEIFPTHTSHISYRNDQARARRKEKVENRWYKDKVLGHGSFGEVCLEVCRQGDNIGDTRAVKKIEKVKMRSWE… |
| U1HLA5 | 1-105 | None |
| U1HS22 | 1-102 | None |
| A0A2S7PAJ2 | 1-106 | None |
| A0A0G4MX51 | 4-122 | None |
| A0A2V1BP79 | 1-98 | None |
| A0A0G4KF54 | 8-122 | None |
| A0A0P7BLF6 | 8-112 | None |
| A0A6G1GGL1 | 5-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.