DPCstruct | MC2950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 255 ± 47 aa |
| Standard deviation of domain lengths | 46.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q54XW6 | 233-434 | NMHWMNVTMIQRQDFEKSQEIQKRLLGWFCLGFSLAPLIATDKGPAYIRSLVQLMEEYDYHFELGSAMQGVKVLLSKKQPTHTVVNE… |
| A0A6H5L1C7 | 40-293 | TNAAAAFYAKPLTEKEMLAADEAKDKLDRMVKVEALVGKRKRFFSYLKKTHEEGGFWLNCVQLTRQGDLAVYAAELSSQRILRLFYL… |
| A0A1J8QNS3 | 44-372 | None |
| A0A1R0GQJ4 | 6-204 | None |
| E3K483 | 14-251 | None |
| M5G9N5 | 19-219 | None |
| A0A1D8NKM6 | 2-205 | None |
| X8JW17 | 1-254 | None |
| A0A0E9NPS5 | 36-317 | None |
| H3HAE4 | 61-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.