DPCstruct | MC29497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 199 ± 21 aa |
| Standard deviation of domain lengths | 21.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2QTC5 | 1-188 | MGGTNWTREEEIIFWLKLIPRSPKRLGQDITKNEEHSWGWVAQQMTKMMAGKTTREYTEQCVLEHYFQNCCGARFSPNAGKLPKKYW… |
| A0A447C224 | 22-262 | GGKAWIREEEFLFWKKLVPFTKKRCGDDIENNEEHEWNWVASEMRKRMREKYLKEGEPDRRNYTGLAMFEHYWQSARHRRPTVAAGR… |
| A0A423X6Y7 | 1-203 | None |
| A0A2L2U292 | 1-224 | None |
| A0A2S4L2R9 | 1-181 | None |
| A0A135SQQ2 | 1-203 | None |
| G2Q8W1 | 1-172 | None |
| A0A4R8PZ80 | 1-195 | None |
| A0A2C5X5B6 | 1-226 | None |
| A0A4Q4UWG4 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.