DPCstruct | MC29493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X4GP01 | 5-111 | LSCAAALALAPVVAASRPVPPAAGGDSFDETYRGRRIQGVRLPEAGRSTSDDAWRITIDGRPLHLMRRADGTWLSMVDHYTSYRTPL… |
| V6U9S2 | 1-89 | MYRGREIRGTATVVVPAGAPADDRVAVAAEPVTEIRIDGRPLHVMRRADGTYLSDVRHYESYPTLLETARAAVDELGTARLAPPAAH… |
| A0A4Q5L167 | 16-143 | None |
| A0A646KQT8 | 38-143 | None |
| A0A0H5CTR2 | 1-114 | None |
| A0A1E4EZ11 | 16-137 | None |
| A0A1Y5XJH1 | 1-90 | None |
| A0A0D8ZWY7 | 1-128 | None |
| A0A371Y053 | 2-123 | None |
| A0A7X0HIU0 | 29-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.