DPCstruct | MC29489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 78 ± 14 aa |
| Standard deviation of domain lengths | 13.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 59.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2Y497 | 21-109 | INTTQKRYAICSALAASAIPALIMSKGHRIEEIPEVPLVVEDKVEGYKKTKEAVLLLKKIKAWNDIKKVYASQRMRAGKGKMRNRRR… |
| K7MZ28 | 1-90 | MLAKEPLKTLVSFTVASVIPSLVLAYDQRIEFVLELPLVVSDSAEGVEKTKEAIKVLKQIRAFPDVEKAKDSHNICLYKGKMHNRRY… |
| A0A3B4U4X4 | 6-68 | None |
| A0A2I3TF82 | 97-162 | None |
| A0A821WCY2 | 1-62 | None |
| A0A2B4SSK7 | 271-359 | None |
| F6HC63 | 1-66 | None |
| A0A1I8FAZ1 | 3-65 | None |
| A0A7J5YZ66 | 263-351 | None |
| J3MJ10 | 270-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.