DPCstruct | MC29485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1V4T2 | 144-259 | IQNFGLNYNLNEEQLSALATRVLEDFASKEPEDYTFYDLSAIRQILCAFNRSVIERIHPSSYREASIMIGKLENCNAEAMSGFATLA… |
| A0A811WJH0 | 229-342 | GLNYNLNQAQLSAIAERVREDFAGKNPEDYTYYDLTALRQILCAFNRSEIERIRPSVYREAAIVLGKLDQCSTDVMQGFATLAVQPK… |
| T1EYE3 | 869-979 | None |
| A0A212EXW9 | 75-187 | None |
| A0A6P8IUI6 | 913-1021 | None |
| A0A194PRS3 | 38-155 | None |
| A0A821LJQ0 | 118-244 | None |
| E0VK79 | 98-202 | None |
| A0A0L7LV34 | 102-222 | None |
| A0A1B0GAQ1 | 470-617 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.