DPCstruct | MC29480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 266 ± 32 aa |
| Standard deviation of domain lengths | 31.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0010- PF21010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DY03 | 1-313 | MSLKNMFSCPFLQRMNAYISKLTWADGSCSDMFCFLNAYKVYEEAHRTGRFKRSVNLGERNWANCFFIQLNTMKDLKSLVDELKTRL… |
| A0A6I9P7W7 | 59-285 | SQKSFFAIPSMQQLAGHRSKLAFAQGAQSDSISFVNAFKAWHSSKKKGQLRHPKDELDWGKENFIQIKRIKEVAELYEDLKKRVSQF… |
| A0A835GCA2 | 1-254 | None |
| A0A1A9VGD0 | 1-300 | None |
| A0A4Y2D7N6 | 13-280 | None |
| A0A4S2JX24 | 9-306 | None |
| Q296Q5 | 629-860 | None |
| A0A811WD10 | 62-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.