DPCstruct | MC2948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 195 ± 28 aa |
| Standard deviation of domain lengths | 27.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3Y9S4 | 7-163 | TEAADPILRGSYAVRNNRRACFVGHWGFSDEAFHNIESVSPFEYTSRIRVPQSRRKDDKRPVSGKYGGFFKLRQFNGSLVKIREEQV… |
| A0A6U3V691 | 3-154 | ETPVLRGNLSIKDGRYIITGKWAFSSDAFKEGDTSKFFLSAPAPDGAELPPGDGVEKFKGYFMMRKEGEEGGKIKVKEKKVKFSFEK… |
| A0A7S3FIF4 | 1-219 | None |
| A0A7S0LNY0 | 112-324 | None |
| M4BS61 | 489-695 | None |
| K3XB60 | 348-502 | None |
| A0A7S4E309 | 246-458 | None |
| A0A6S8XDT4 | 15-170 | None |
| A0A7S4AEH9 | 69-282 | None |
| A0A7R9W2E7 | 1-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.