DPCstruct | MC29479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 13.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7LJN6 | 1-117 | MVHFTPLQERGESNSPYSIYNQLSFSPDLFEEGTPREERVKKVKDLVTRMEHMGLLAMTDVVWNHTANNSDWLLDHPEAGYNLVNSP… |
| A0A833YHI1 | 159-277 | HFTPLQALGESRSCYSLADQLELNPDFSRPNKKCTWHDVGQLVEKLKKEWNILCITDVVYNHTAANSKWIQEHPESAYNLVNSPHLR… |
| A0A5M9KDW6 | 121-234 | None |
| A0A2R7X2Q5 | 166-291 | None |
| A0A817LNU7 | 317-462 | None |
| A0A821IFA8 | 72-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.